(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE5

CP001994.PE5         Location/Qualifiers
FT   CDS             4690..5937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0005"
FT                   /product="peptide chain release factor subunit 1 (aeRF-1)"
FT                   /note="COGs: COG1503 Peptide chain release factor 1 (eRF1);
FT                   InterPro IPR005140:IPR005142:IPR005141; KEGG: hypothetical
FT                   protein; K03265 peptide chain release factor eRF subunit 1;
FT                   PFAM: eRF1 domain 1 protein; eRF1 domain 3 protein; eRF1
FT                   domain 2 protein; SPTR: Q12V98 Peptide chain release factor
FT                   subunit 1; PFAM: eRF1 domain 3; eRF1 domain 2; eRF1 domain
FT                   1; TIGRFAM: peptide chain release factor eRF/aRF, subunit
FT                   1; peptide chain release factor 1, archaeal and eukaryotic
FT                   forms"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35543"
FT                   /db_xref="GOA:D5E8N4"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N4"
FT                   /protein_id="ADE35543.1"
FT                   /translation="MAEQSAHEKYEFKKKLESLRNKKGRGTELISLYIPPDKQLSDVTS
FT                   QLKTEHSQASNIKSKVTRTNVQSAIDSLLSRLKYLKIPENGIVYFTGAVDIGADKTNME
FT                   TTTIIPPQPLTIYKYHCDSAFFLEPLEGMLKDAKTYGLLVLDRREATIGLLTGKHIEPY
FT                   RNLTSTVPGKQRKGGQSAQRFQQLRLIAIHDFYKRIGDAASEIFLTVDMKDFEGILLGG
FT                   PSPTKEEFQSGEFLHHELQRKILGLFDVAYTDESGLQELVNAASERLQDLDLMVEKNLM
FT                   QKFFKELVSDSGKAAYGEEVVRQNLMIGAVEILLISEDLRSERIKVRCTDGDYEDNITR
FT                   ENQPDQKSVDDFGNCPKCGSPLEVVERVDIVDELSDLSDQMGSEVAFISTDFEEGGQLL
FT                   NAFGGIVAILRYNTGM"
     MAEQSAHEKY EFKKKLESLR NKKGRGTELI SLYIPPDKQL SDVTSQLKTE HSQASNIKSK        60
     VTRTNVQSAI DSLLSRLKYL KIPENGIVYF TGAVDIGADK TNMETTTIIP PQPLTIYKYH       120
     CDSAFFLEPL EGMLKDAKTY GLLVLDRREA TIGLLTGKHI EPYRNLTSTV PGKQRKGGQS       180
     AQRFQQLRLI AIHDFYKRIG DAASEIFLTV DMKDFEGILL GGPSPTKEEF QSGEFLHHEL       240
     QRKILGLFDV AYTDESGLQE LVNAASERLQ DLDLMVEKNL MQKFFKELVS DSGKAAYGEE       300
     VVRQNLMIGA VEILLISEDL RSERIKVRCT DGDYEDNITR ENQPDQKSVD DFGNCPKCGS       360
     PLEVVERVDI VDELSDLSDQ MGSEVAFIST DFEEGGQLLN AFGGIVAILR YNTGM            415
//

If you have problems or comments...

PBIL Back to PBIL home page