(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE500

CP001994.PE500       Location/Qualifiers
FT   CDS             complement(529017..529652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0511"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG1387 Histidinol phosphatase and related
FT                   hydrolase of the PHP family; InterPro IPR004013:IPR003141;
FT                   KEGG: dal:Dalk_2412 response regulator receiver protein;
FT                   PFAM: PHP domain protein; SMART: phosphoesterase PHP domain
FT                   protein; SPTR: Q12WR1 PHP-like protein; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36038"
FT                   /db_xref="GOA:D5EA37"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA37"
FT                   /protein_id="ADE36038.1"
FT                   /translation="MIDLHTHTIFSDGELIPSEQVRRAKTLGYEAIGLTDHADFTNVEH
FT                   ILNCVTKAKYLEEPMEIKVLPGIEITHVPPEKIASLAKLARELGAEIVVVHGESPVEPV
FT                   LPGTNLAAAQCSDVDILAHPGFITEEEAKIATDNNVCLEITSRGGHNRTNGHVVKIAKL
FT                   SGATMVVDTDSHHPSDLITTSTALKVAMGAGLEKDEAKQVLENSRALI"
     MIDLHTHTIF SDGELIPSEQ VRRAKTLGYE AIGLTDHADF TNVEHILNCV TKAKYLEEPM        60
     EIKVLPGIEI THVPPEKIAS LAKLARELGA EIVVVHGESP VEPVLPGTNL AAAQCSDVDI       120
     LAHPGFITEE EAKIATDNNV CLEITSRGGH NRTNGHVVKI AKLSGATMVV DTDSHHPSDL       180
     ITTSTALKVA MGAGLEKDEA KQVLENSRAL I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page