(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE501

CP001994.PE501       Location/Qualifiers
FT   CDS             529786..530088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0512"
FT                   /product="protein of unknown function DUF211"
FT                   /note="COGs: COG1888 conserved hypothetical protein;
FT                   InterPro IPR003831; KEGG: dps:DP2436 hypothetical protein;
FT                   PFAM: protein of unknown function DUF211; SPTR: Q12WR2
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   ArCR, COG1888"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36039"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA38"
FT                   /protein_id="ADE36039.1"
FT                   /translation="MMNNKSGIRRLVLDVLKPHNPSIVELAGVLGDVEGVDGVNLSLYE
FT                   MDQKTENVKITLEGMDLDYELIRQEIENMGAVVHSVDEIAAGKKIIEEVETHQDR"
     MMNNKSGIRR LVLDVLKPHN PSIVELAGVL GDVEGVDGVN LSLYEMDQKT ENVKITLEGM        60
     DLDYELIRQE IENMGAVVHS VDEIAAGKKI IEEVETHQDR                             100
//

If you have problems or comments...

PBIL Back to PBIL home page