(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE502

CP001994.PE502       Location/Qualifiers
FT   CDS             complement(530092..530886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0513"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0293 23S rRNA methylase; InterPro
FT                   IPR002877:IPR002792; KEGG: mmw:Mmwyl1_1019 ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; deoxyribonuclease/rho
FT                   motif-related TRAM; SPTR: Q8TR92 Ribosomal RNA large
FT                   subunit methyltransferase J; PFAM: FtsJ-like
FT                   methyltransferase; TRAM domain; TIGRFAM: cell division
FT                   protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36040"
FT                   /db_xref="GOA:D5EA39"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA39"
FT                   /protein_id="ADE36040.1"
FT                   /translation="MARHRRDTYYWRAKAEGYRSRAAYKLQQINKKFNVIREDSDVVDL
FT                   GAAPGGWLEVARELTKRKVVGVDILRIKPMDRITIIRGDITREETVSQIKEAVGEDGAD
FT                   AVICDAAPNLSGNWNLDHARSIALAESALECATRILKPQGNFVVKVFQGDMFKEYLDKV
FT                   RGEFTYVRAHSPEASRSESAEIYVVGKKFLTAPIRKGEEYDVVIERMGSGGDGTAFVEG
FT                   FVVFICDTEKGEKVRIKVRDVKPNFAFADVIQRLESPEEEEK"
     MARHRRDTYY WRAKAEGYRS RAAYKLQQIN KKFNVIREDS DVVDLGAAPG GWLEVARELT        60
     KRKVVGVDIL RIKPMDRITI IRGDITREET VSQIKEAVGE DGADAVICDA APNLSGNWNL       120
     DHARSIALAE SALECATRIL KPQGNFVVKV FQGDMFKEYL DKVRGEFTYV RAHSPEASRS       180
     ESAEIYVVGK KFLTAPIRKG EEYDVVIERM GSGGDGTAFV EGFVVFICDT EKGEKVRIKV       240
     RDVKPNFAFA DVIQRLESPE EEEK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page