(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE504

CP001994.PE504       Location/Qualifiers
FT   CDS             531596..532804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0515"
FT                   /product="Phosphopantothenoylcysteine decarboxylase;
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro
FT                   IPR007085:IPR003382:IPR005252; KEGG: gbm:Gbem_1667
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein; SPTR: Q466Q5 Phosphopantothenate-cysteine
FT                   ligase / Phosphopantothenoylcysteine decarboxylase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA / pantothenate metabolism flavoprotein; Flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36042"
FT                   /db_xref="GOA:D5EA41"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA41"
FT                   /protein_id="ADE36042.1"
FT                   /translation="MHSTLWIKGTKSKSLEGKTVVLAVTGSIAAVRVVELARELIRNGA
FT                   NVYAVMSEAATRILHPDALHYATGHEVITDITGGVEHVGMCGLQGMADLLLIAPATANT
FT                   ISKIAMGIDDTPVTTFATTAIGSGVATIVVPAMHQSMYDHPAVNSNLEKLGSYGISLVG
FT                   PRVEEGIAKIAPNDDIVLAVERELMGKKLAGKKIVLTSGATAEAIDPIRIITNRASGKT
FT                   GQELAREAFRRGGDVTIIHRNELDADGINEVYAESAASMLDSCMEEIGRGCDVFISSAA
FT                   ISDYTLDSLGSKIKSGQKLILEMHPTEKILPQVRSNYPAIVTVGFKAETGVGEKELVGS
FT                   ATRMLEEYGLDMVVANDVMAGGMGTSENSIYILQDESSASHYSGSKRYLASIIMDRVEQ
FT                   ILL"
     MHSTLWIKGT KSKSLEGKTV VLAVTGSIAA VRVVELAREL IRNGANVYAV MSEAATRILH        60
     PDALHYATGH EVITDITGGV EHVGMCGLQG MADLLLIAPA TANTISKIAM GIDDTPVTTF       120
     ATTAIGSGVA TIVVPAMHQS MYDHPAVNSN LEKLGSYGIS LVGPRVEEGI AKIAPNDDIV       180
     LAVERELMGK KLAGKKIVLT SGATAEAIDP IRIITNRASG KTGQELAREA FRRGGDVTII       240
     HRNELDADGI NEVYAESAAS MLDSCMEEIG RGCDVFISSA AISDYTLDSL GSKIKSGQKL       300
     ILEMHPTEKI LPQVRSNYPA IVTVGFKAET GVGEKELVGS ATRMLEEYGL DMVVANDVMA       360
     GGMGTSENSI YILQDESSAS HYSGSKRYLA SIIMDRVEQI LL                          402
//

If you have problems or comments...

PBIL Back to PBIL home page