(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE506

CP001994.PE506       Location/Qualifiers
FT   CDS             complement(533716..534567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0517"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: afw:Anae109_2816
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: Q12YH0 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36044"
FT                   /db_xref="GOA:D5EA43"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA43"
FT                   /protein_id="ADE36044.1"
FT                   /translation="MIPVELMAIFFGLASAVSWGAGDFTGGCASRRTNVYSVVLVTQIV
FT                   GVVLFPILAFVFSENLPPLSKLVWGCLAGFFGTSGLLALYQGLVEGKMGIVAPVAAVIS
FT                   AIVPVIYSAFYEGFPEILRIAGFIFAFIAVWFIVSMDNGPKVKINDLKYPLIAGMGFGL
FT                   FFISIDNFSETAIFWPLAFARGTALLMFLVFVILTGSVKVKPPSIDVLPVIVLAGLFNT
FT                   GGGTFFALASEAGRLDITTILSSLSPGATVLLAYFILKEKLAPRQWLGVASALFAIILM
FT                   SI"
     MIPVELMAIF FGLASAVSWG AGDFTGGCAS RRTNVYSVVL VTQIVGVVLF PILAFVFSEN        60
     LPPLSKLVWG CLAGFFGTSG LLALYQGLVE GKMGIVAPVA AVISAIVPVI YSAFYEGFPE       120
     ILRIAGFIFA FIAVWFIVSM DNGPKVKIND LKYPLIAGMG FGLFFISIDN FSETAIFWPL       180
     AFARGTALLM FLVFVILTGS VKVKPPSIDV LPVIVLAGLF NTGGGTFFAL ASEAGRLDIT       240
     TILSSLSPGA TVLLAYFILK EKLAPRQWLG VASALFAIIL MSI                         283
//

If you have problems or comments...

PBIL Back to PBIL home page