(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE511

CP001994.PE511       Location/Qualifiers
FT   CDS             539120..540319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0522"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: dal:Dalk_2506 methionine
FT                   adenosyltransferase; PFAM: S-adenosylmethionine synthetase;
FT                   PRIAM: Methionine adenosyltransferase; SPTR: Q8CXS7
FT                   S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36049"
FT                   /db_xref="GOA:D5EA48"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA48"
FT                   /protein_id="ADE36049.1"
FT                   /translation="MSKLKYDHVFTSESVGAGHPDKICDQVSDAVLDACLEFDPNSRVA
FT                   CETLVAHDLVVNAGEITCKGMEKIDTEKIAREVVRDIGYDHKDLLFWDKSFEYISKIHE
FT                   QSPDISMGVTEGTGLYEEQGAGDQGMMFGYATNETDEYMPAPIAYSHRLLRYLDSIRQE
FT                   GRVSYLRPDAKSQVSVKYVNGKPDHITAVVVSQQTDDIPLETVRNEMVGFINEVLEPTG
FT                   MLRSDTEYYINPTGAFVLGGPYADAGVTGRKIIVDTYGGVGSHGGGAFSGKDPSKVDRS
FT                   AAYYARYVAKNIVAAGLADKCEIQVAYAIGVSKPLSINVDTYGTGVIEDQEIQDVLESG
FT                   EIFDFRPAALIEDLNLLHPKGWSYRQASSYGHFGRNIFPWEQLDKVDSLKGKFNLNVVK
FT                   "
     MSKLKYDHVF TSESVGAGHP DKICDQVSDA VLDACLEFDP NSRVACETLV AHDLVVNAGE        60
     ITCKGMEKID TEKIAREVVR DIGYDHKDLL FWDKSFEYIS KIHEQSPDIS MGVTEGTGLY       120
     EEQGAGDQGM MFGYATNETD EYMPAPIAYS HRLLRYLDSI RQEGRVSYLR PDAKSQVSVK       180
     YVNGKPDHIT AVVVSQQTDD IPLETVRNEM VGFINEVLEP TGMLRSDTEY YINPTGAFVL       240
     GGPYADAGVT GRKIIVDTYG GVGSHGGGAF SGKDPSKVDR SAAYYARYVA KNIVAAGLAD       300
     KCEIQVAYAI GVSKPLSINV DTYGTGVIED QEIQDVLESG EIFDFRPAAL IEDLNLLHPK       360
     GWSYRQASSY GHFGRNIFPW EQLDKVDSLK GKFNLNVVK                              399
//

If you have problems or comments...

PBIL Back to PBIL home page