(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE52

CP001994.PE52        Location/Qualifiers
FT   CDS             57616..59436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0053"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR001347:IPR000583:IPR005855; KEGG:
FT                   gbm:Gbem_0090 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; SPTR: Q12TM9
FT                   Glutamine--fructose-6-phosphate transaminase; TIGRFAM:
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: SIS domain; Glutamine amidotransferases
FT                   class-II; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35590"
FT                   /db_xref="GOA:D5E8T1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T1"
FT                   /protein_id="ADE35590.1"
FT                   /translation="MCGIVGYVGKTGASSVIMDCLRRLEYRGYDSAGLSVLNGDLQTYK
FT                   AAGSISELDKVLPAEIKGNIGIGHTRWATHGMPNDVNAHPHCSSDIVVVHNGIIENYLK
FT                   LKEWLEDEGYEFVSDTDTEVIAHLVHFNSNSLDLFEAVHKSMAVLEGSYAIAVMSKNNP
FT                   DTLIASRKDSPLIVGLGENEFFTSSDATAFVAHTRDVIFVDDREIVKLTPEKVEFYDME
FT                   GQLLEKQISTIDWDVEAAEKSGYAHFMLKEIHEQTRSLQKTFAGKLAELEGNVRLTELK
FT                   LTDEQIRNINRVEIIACGTSWNAGLFGKYLLETLAGMHTDVSAASEFRYRDPVMDENVL
FT                   TIAITQSGETADTLAAIRNVVQYESSTIAITNVVGSTITREAENVVYTHAGPEIGVAAT
FT                   KTFTAQLIALYLLAIYMGRKRNYLLPDEAKDVIKALKELPGHVQQVLNQRDQIRKNAAQ
FT                   YADCRDYYFIGRGLNYPAALEAALKLKEISYIHAEGYAAGELKHGPLALLEKGTPVVAI
FT                   VTKNRTYAKMLSNIKEVKARGAEVIAVADERDREIGKYADLVIFVPATNPLLSPVLSSV
FT                   ALQLLAYYTALEKGCEIDKPRNLAKSVTVE"
     MCGIVGYVGK TGASSVIMDC LRRLEYRGYD SAGLSVLNGD LQTYKAAGSI SELDKVLPAE        60
     IKGNIGIGHT RWATHGMPND VNAHPHCSSD IVVVHNGIIE NYLKLKEWLE DEGYEFVSDT       120
     DTEVIAHLVH FNSNSLDLFE AVHKSMAVLE GSYAIAVMSK NNPDTLIASR KDSPLIVGLG       180
     ENEFFTSSDA TAFVAHTRDV IFVDDREIVK LTPEKVEFYD MEGQLLEKQI STIDWDVEAA       240
     EKSGYAHFML KEIHEQTRSL QKTFAGKLAE LEGNVRLTEL KLTDEQIRNI NRVEIIACGT       300
     SWNAGLFGKY LLETLAGMHT DVSAASEFRY RDPVMDENVL TIAITQSGET ADTLAAIRNV       360
     VQYESSTIAI TNVVGSTITR EAENVVYTHA GPEIGVAATK TFTAQLIALY LLAIYMGRKR       420
     NYLLPDEAKD VIKALKELPG HVQQVLNQRD QIRKNAAQYA DCRDYYFIGR GLNYPAALEA       480
     ALKLKEISYI HAEGYAAGEL KHGPLALLEK GTPVVAIVTK NRTYAKMLSN IKEVKARGAE       540
     VIAVADERDR EIGKYADLVI FVPATNPLLS PVLSSVALQL LAYYTALEKG CEIDKPRNLA       600
     KSVTVE                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page