(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE520

CP001994.PE520       Location/Qualifiers
FT   CDS             550421..553081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0531"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit;
FT                   InterProIPR007066:IPR000722:IPR007083:IPR007080:IPR
FT                   006592:IPR012758; KEGG: rpb1; RNA polymerase II core
FT                   subunit; K03006 DNA-directed RNA polymerase II subunit A;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; SMART: RNA polymerase I subunit A domain protein;
FT                   SPTR: Q12WS6 DNA-directed RNA polymerase; TIGRFAM:
FT                   DNA-directed RNA polymerase subunit A'; PFAM: RNA
FT                   polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain 4;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   3; RNA polymerase Rpb1, domain 5; TIGRFAM: DNA-directed RNA
FT                   polymerase subunit A'"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36058"
FT                   /db_xref="GOA:D5EA57"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA57"
FT                   /protein_id="ADE36058.1"
FT                   /translation="MMVISMDNTIPSIPQRIGAIRFGLLSPREIRKMSVTSIITADTYD
FT                   DDGYPIDMGLMDLRLGVIDPGLKCKTCGGRAGECPGHFGHIELVAPVLHVGFNKIIRKI
FT                   LRSTCRNCSHLLLEDKQKKAYINQFAKLDVMSHLPDDLINNVFKEARKTKICPYCGEEQ
FT                   LEIKFEKPSDYIENDYKLTPTEIRDRLERIPDDDLKVMGMDPESARPEWMVLTVLAVPP
FT                   VTVRPSITLESGQRSEDDLTHKLVDIIRINQRFQENRDAGAPQLIIEDLWELLQYHLTT
FT                   FFDNEVSGVPPARHRSGRPLKTLTQRLKGKEGRFRGSLSGKRVNFSARTVVSPDPNLSI
FT                   NEVGVPYQIAKHMTIPVRVISRNLEMMRAYVARGGETHPGANYVFREDGRRLKITEANK
FT                   EELSEKLEPGWTVERQMQDGDIVLFNRQPSLHKMSIMAHKVKVLPNKTFKLNPAVCPPY
FT                   NADFDGDEMNMHVLQTEESRAEANILMQVQENILSPRFGGPIIGGIHDHISGMFLLTRN
FT                   ENMISKNDALELLRKSEVRELPEPAGYTDVGDPFWTGKQIFSQILPKDLNLEFKANVCF
FT                   KCDVCKGRDCEYDAYVVVENGELVTGTIDEKAIGAFKGKILDSIVKRYGTTEAAQFVDD
FT                   MTRLAIRGVMRTGLSFGISDEDIPREAKLNIDEELERAENEVAELIQAYEAKELEPLPG
FT                   RTLAETIELKIMQSLGKARDHTGTIAGNHLGLENSAVIMAKSGARGSMLNLTQMAACVG
FT                   QQAVRGERIRRGYEGRTLPHFDRGDLGADAHGFVKSSYKSGLNPTEYFFHSVGGREGLV
FT                   DTAVRTSQSGYLQRRLVNALQDLEVQYDRSVRETRGVIVQFKYGEDGIDSTKSDYSSEE
FT                   TVHNIVRSVTGKEVK"
     MMVISMDNTI PSIPQRIGAI RFGLLSPREI RKMSVTSIIT ADTYDDDGYP IDMGLMDLRL        60
     GVIDPGLKCK TCGGRAGECP GHFGHIELVA PVLHVGFNKI IRKILRSTCR NCSHLLLEDK       120
     QKKAYINQFA KLDVMSHLPD DLINNVFKEA RKTKICPYCG EEQLEIKFEK PSDYIENDYK       180
     LTPTEIRDRL ERIPDDDLKV MGMDPESARP EWMVLTVLAV PPVTVRPSIT LESGQRSEDD       240
     LTHKLVDIIR INQRFQENRD AGAPQLIIED LWELLQYHLT TFFDNEVSGV PPARHRSGRP       300
     LKTLTQRLKG KEGRFRGSLS GKRVNFSART VVSPDPNLSI NEVGVPYQIA KHMTIPVRVI       360
     SRNLEMMRAY VARGGETHPG ANYVFREDGR RLKITEANKE ELSEKLEPGW TVERQMQDGD       420
     IVLFNRQPSL HKMSIMAHKV KVLPNKTFKL NPAVCPPYNA DFDGDEMNMH VLQTEESRAE       480
     ANILMQVQEN ILSPRFGGPI IGGIHDHISG MFLLTRNENM ISKNDALELL RKSEVRELPE       540
     PAGYTDVGDP FWTGKQIFSQ ILPKDLNLEF KANVCFKCDV CKGRDCEYDA YVVVENGELV       600
     TGTIDEKAIG AFKGKILDSI VKRYGTTEAA QFVDDMTRLA IRGVMRTGLS FGISDEDIPR       660
     EAKLNIDEEL ERAENEVAEL IQAYEAKELE PLPGRTLAET IELKIMQSLG KARDHTGTIA       720
     GNHLGLENSA VIMAKSGARG SMLNLTQMAA CVGQQAVRGE RIRRGYEGRT LPHFDRGDLG       780
     ADAHGFVKSS YKSGLNPTEY FFHSVGGREG LVDTAVRTSQ SGYLQRRLVN ALQDLEVQYD       840
     RSVRETRGVI VQFKYGEDGI DSTKSDYSSE ETVHNIVRSV TGKEVK                      886
//

If you have problems or comments...

PBIL Back to PBIL home page