(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE523

CP001994.PE523       Location/Qualifiers
FT   CDS             554621..555046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0534"
FT                   /product="NusA family KH domain protein"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR004044:IPR010212; KEGG: nam:NAMH_0269
FT                   transcription termination factor NusA; PFAM: KH type 2
FT                   domain protein; SPTR: Q12WS9 NusA anti-termination factor;
FT                   TIGRFAM: NusA family KH domain protein; PFAM: KH domain;
FT                   TIGRFAM: NusA family KH domain protein, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36061"
FT                   /db_xref="GOA:D5EA60"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA60"
FT                   /protein_id="ADE36061.1"
FT                   /translation="MSDIKLSTDAIRYIALFESMTGAPIKDCLIDDDRIICVVNNGDMG
FT                   AAIGKHGDNINRFKKAVDKHVDLIEYSDDPITFIKNAFGTIPTKSVEISDKNGKKVAYV
FT                   EVSSMNKGLAIGKSGRNIDKIKRIVNRHHDIEDLILQ"
     MSDIKLSTDA IRYIALFESM TGAPIKDCLI DDDRIICVVN NGDMGAAIGK HGDNINRFKK        60
     AVDKHVDLIE YSDDPITFIK NAFGTIPTKS VEISDKNGKK VAYVEVSSMN KGLAIGKSGR       120
     NIDKIKRIVN RHHDIEDLIL Q                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page