(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE53

CP001994.PE53        Location/Qualifiers
FT   CDS             59450..60745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0054"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR005844:IPR005846:IPR005843:IPR
FT                   005845:IPR016066; KEGG: cla:Cla_1567
FT                   phosphoglucomutase/phosphomannomutase family protein; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; PRIAM: Phosphoglucosamine mutase; SPTR: Q46AY7
FT                   Probable phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35591"
FT                   /db_xref="GOA:D5E8T2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T2"
FT                   /protein_id="ADE35591.1"
FT                   /translation="MKLFGSSGIRGLANKVIGPELALNVGMAVGTMADSVVIGKDPRIA
FT                   ADMIEQALIAGLSATGCEVTLGGLMSTPTLAFATVDYDCGIMITASHNPAEDVGIKLWN
FT                   PDGMAFDSQQQKRIEHIIENNEYATVTWNEVGNVKYEEGFVKRHCNAILSRMQPSHKRV
FT                   VVDCGCGAGCTITPYLLRQLGCEVISLNCQPDGYFPARNCEPAEKNLGQLIKAVRAFEA
FT                   DIGIAHDGDADRMMVVDEQGNFVSGDELLALFALQQKQDKVVVPVDTSMIVDDALGDTK
FT                   VLRCRVGDVYVAEQIKASGAYFGGEPSGSWIFPDVSYCPDGIYAAARIVGMIENSSLSK
FT                   MVVDLPHYTTLRDTIECAEDRKEAAMQRIKQSLEMMGNVTTIDGIRVDMENGWVLVRPS
FT                   GTEPKIRITAEAREDVDELFDKVMRIARGAIQ"
     MKLFGSSGIR GLANKVIGPE LALNVGMAVG TMADSVVIGK DPRIAADMIE QALIAGLSAT        60
     GCEVTLGGLM STPTLAFATV DYDCGIMITA SHNPAEDVGI KLWNPDGMAF DSQQQKRIEH       120
     IIENNEYATV TWNEVGNVKY EEGFVKRHCN AILSRMQPSH KRVVVDCGCG AGCTITPYLL       180
     RQLGCEVISL NCQPDGYFPA RNCEPAEKNL GQLIKAVRAF EADIGIAHDG DADRMMVVDE       240
     QGNFVSGDEL LALFALQQKQ DKVVVPVDTS MIVDDALGDT KVLRCRVGDV YVAEQIKASG       300
     AYFGGEPSGS WIFPDVSYCP DGIYAAARIV GMIENSSLSK MVVDLPHYTT LRDTIECAED       360
     RKEAAMQRIK QSLEMMGNVT TIDGIRVDME NGWVLVRPSG TEPKIRITAE AREDVDELFD       420
     KVMRIARGAI Q                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page