(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE55

CP001994.PE55        Location/Qualifiers
FT   CDS             complement(62203..63648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0056"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445:IPR004772; KEGG:
FT                   sat:SYN_02617 trk system potassium uptake protein; PFAM:
FT                   cation transporter; SPTR: Q12X31 K+ transporter Trk;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35593"
FT                   /db_xref="GOA:D5E8T4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T4"
FT                   /protein_id="ADE35593.1"
FT                   /translation="MSGLRINIVLGAIGSILWIIGGLMIIPFMVAVYYGESLFPFSLSL
FT                   TITLLIAFIFSLMLTEERGEWNMREGFMIVALGWLTAAIFSSMPYIFEGTPPINALFEA
FT                   MSGVTATGATALADIESYSKSLLFWRAMTQWVGGMGIILLFIVVLPKLGVAGRQMFRAE
FT                   VPGLKEEQLRPRIRETATLLWFVYVGLSIVEFILLYFAGLNAYDAITHTFTSISCAGFS
FT                   TYSDSIAAFNNTTVEGIFLIFMILGGANIALHYKTIFSDKTSLIKDEEFKFYLLIILIA
FT                   TLVLAYTLTRGEVYAIADSFRYSLFHVVSILTTTGYATTDFNMWPDSSRFILFLLMFIG
FT                   GCAGSTSGGIKVVRVLLLMKYADNVLFRTIHTKAIRPIRFNHRRIPEEIMHAIVSFLII
FT                   YFMIFIASATLLSLMGVDFVTTLSASIATLGNVGPGLGLVGPMANYGTLPDLGMLVLTA
FT                   NMWIGRLEVFTVMVLLTPAFWRH"
     MSGLRINIVL GAIGSILWII GGLMIIPFMV AVYYGESLFP FSLSLTITLL IAFIFSLMLT        60
     EERGEWNMRE GFMIVALGWL TAAIFSSMPY IFEGTPPINA LFEAMSGVTA TGATALADIE       120
     SYSKSLLFWR AMTQWVGGMG IILLFIVVLP KLGVAGRQMF RAEVPGLKEE QLRPRIRETA       180
     TLLWFVYVGL SIVEFILLYF AGLNAYDAIT HTFTSISCAG FSTYSDSIAA FNNTTVEGIF       240
     LIFMILGGAN IALHYKTIFS DKTSLIKDEE FKFYLLIILI ATLVLAYTLT RGEVYAIADS       300
     FRYSLFHVVS ILTTTGYATT DFNMWPDSSR FILFLLMFIG GCAGSTSGGI KVVRVLLLMK       360
     YADNVLFRTI HTKAIRPIRF NHRRIPEEIM HAIVSFLIIY FMIFIASATL LSLMGVDFVT       420
     TLSASIATLG NVGPGLGLVG PMANYGTLPD LGMLVLTANM WIGRLEVFTV MVLLTPAFWR       480
     H                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page