(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE58

CP001994.PE58        Location/Qualifiers
FT   CDS             complement(64488..65117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0059"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: gem:GM21_3051 lysine exporter
FT                   protein (LysE/YggA); PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: Q8TP18 LysE type translocator; PFAM:
FT                   LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35596"
FT                   /db_xref="GOA:D5E8T7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T7"
FT                   /protein_id="ADE35596.1"
FT                   /translation="MYEITEFLVTGILLGFAAGISPGPLMAITISESLQHGSKEGFKVA
FT                   ISPLITDFLIVSAVIYILMHFQQQNSVIALISLAGALYLMQLGIASLRTKNISIEITNQ
FT                   KKESLKKGILANFLNPHPYLFWIAIGGPILFRASEVDRLAQIMFVIGFYVLLVGSKVVI
FT                   ALFVGKSKDFLKSKYYLHLFRSLGILYLIFALVFIEQGLELLGLHV"
     MYEITEFLVT GILLGFAAGI SPGPLMAITI SESLQHGSKE GFKVAISPLI TDFLIVSAVI        60
     YILMHFQQQN SVIALISLAG ALYLMQLGIA SLRTKNISIE ITNQKKESLK KGILANFLNP       120
     HPYLFWIAIG GPILFRASEV DRLAQIMFVI GFYVLLVGSK VVIALFVGKS KDFLKSKYYL       180
     HLFRSLGILY LIFALVFIEQ GLELLGLHV                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page