(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE63

CP001994.PE63        Location/Qualifiers
FT   CDS             68139..69143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0064"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TSD7 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35601"
FT                   /db_xref="GOA:D5E8U2"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U2"
FT                   /protein_id="ADE35601.1"
FT                   /translation="MLGIFELIAVALCIVFVLVLTVKVWKNRTYSGTKKIFLSLAVLLF
FT                   MTVLVYGLFFFVLVDSDQASYYTTGGKNFENINDERILENAKEAGYQIQGPFFVNVRAQ
FT                   DSTGIYPDDLPELENHLGTEYILKFSTYYYNADTIMEIMFIDEDVTTITFFNYSRPDPY
FT                   FSPFKVEHLPDDRWIIDRMVAVFGFDEQTARGHLQEMKAEIENENRPKMELSRSIAPSS
FT                   LYADLQNMSTSSKFSLTYGEGNTALLFYEDERLAGKINCVVPNHRIVHVTDEATYTIKV
FT                   DKLGGVDLHVELPVGERIPEETYTAGFKKMFKDIGLPEAAVDEYEFNYSSSVW"
     MLGIFELIAV ALCIVFVLVL TVKVWKNRTY SGTKKIFLSL AVLLFMTVLV YGLFFFVLVD        60
     SDQASYYTTG GKNFENINDE RILENAKEAG YQIQGPFFVN VRAQDSTGIY PDDLPELENH       120
     LGTEYILKFS TYYYNADTIM EIMFIDEDVT TITFFNYSRP DPYFSPFKVE HLPDDRWIID       180
     RMVAVFGFDE QTARGHLQEM KAEIENENRP KMELSRSIAP SSLYADLQNM STSSKFSLTY       240
     GEGNTALLFY EDERLAGKIN CVVPNHRIVH VTDEATYTIK VDKLGGVDLH VELPVGERIP       300
     EETYTAGFKK MFKDIGLPEA AVDEYEFNYS SSVW                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page