(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE66

CP001994.PE66        Location/Qualifiers
FT   CDS             complement(70496..71242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0067"
FT                   /product="protein of unknown function DUF541"
FT                   /note="COGs: COG2968 conserved hypothetical protein;
FT                   InterPro IPR007497; KEGG: mes:Meso_2073 hypothetical
FT                   protein; PFAM: protein of unknown function DUF541; SPTR:
FT                   Q8TTW4 Outer membrane protein; PFAM: Protein of unknown
FT                   function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35604"
FT                   /db_xref="GOA:D5E8U5"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U5"
FT                   /protein_id="ADE35604.1"
FT                   /translation="MAQENNKDKSYYIIIALSVVLVLMAATLYAGSVGGSDSNSENTLQ
FT                   MNGNAEMMVVPDTATLNIGAEVMAPTAEEASQENAVIMNAVIEELKGLGLEDEDIRTSY
FT                   VSVRPEYNYGEKTRTIEGYSASNSVQVTTTNLDNLGEMIDRSASAGANQIGGISFAVSD
FT                   EKQKELHEDLITEAVADASSKAEILAENLGVEIVGVKSSSISDGTPPRTYYEESVAMDA
FT                   AEKPATPIEPGESRVSMSVRVTYIIQ"
     MAQENNKDKS YYIIIALSVV LVLMAATLYA GSVGGSDSNS ENTLQMNGNA EMMVVPDTAT        60
     LNIGAEVMAP TAEEASQENA VIMNAVIEEL KGLGLEDEDI RTSYVSVRPE YNYGEKTRTI       120
     EGYSASNSVQ VTTTNLDNLG EMIDRSASAG ANQIGGISFA VSDEKQKELH EDLITEAVAD       180
     ASSKAEILAE NLGVEIVGVK SSSISDGTPP RTYYEESVAM DAAEKPATPI EPGESRVSMS       240
     VRVTYIIQ                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page