(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE68

CP001994.PE68        Location/Qualifiers
FT   CDS             complement(73474..73827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0069"
FT                   /product="protein of unknown function UPF0132"
FT                   /note="COGs: COG4818 membrane protein; InterPro IPR005348;
FT                   KEGG: hypothetical protein; PFAM: protein of unknown
FT                   function UPF0132; SPTR: Q58838 UPF0132 membrane protein
FT                   MJ1443; PFAM: Chloroplast import component protein (Tic20)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35606"
FT                   /db_xref="GOA:D5E8U7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U7"
FT                   /protein_id="ADE35606.1"
FT                   /translation="MSETSTGLEENIAGVLTYLLGLITGIIFLIIEKKNKSVRFNAAQS
FT                   IVVFGGLFVLNIILSMVPVLGGVISTLIGLISLILWVYLMYMTYTGNLVRLPVASEYAD
FT                   KIIAGDTELDRSE"
     MSETSTGLEE NIAGVLTYLL GLITGIIFLI IEKKNKSVRF NAAQSIVVFG GLFVLNIILS        60
     MVPVLGGVIS TLIGLISLIL WVYLMYMTYT GNLVRLPVAS EYADKIIAGD TELDRSE          117
//

If you have problems or comments...

PBIL Back to PBIL home page