(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE7

CP001994.PE7         Location/Qualifiers
FT   CDS             7656..7925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0007"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="COGs: COG3326 membrane protein; InterPro IPR010718;
FT                   KEGG: hps:HPSH_01780 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1294; SPTR: Q12V96 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1294)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35545"
FT                   /db_xref="GOA:D5E8N6"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N6"
FT                   /protein_id="ADE35545.1"
FT                   /translation="MFSLEQLVLAYIGLASLFSFVIMGIDKKKAVKGAYRISEKFLFIC
FT                   AFAGGSVGILAGMYIFRHKIRRWKFKLGIPLILVLEMYLYVKFI"
     MFSLEQLVLA YIGLASLFSF VIMGIDKKKA VKGAYRISEK FLFICAFAGG SVGILAGMYI        60
     FRHKIRRWKF KLGIPLILVL EMYLYVKFI                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page