(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE84

CP001994.PE84        Location/Qualifiers
FT   CDS             complement(91776..92351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0086"
FT                   /product="methyltransferase FkbM family"
FT                   /note="InterPro IPR006342; KEGG: acp:A2cp1_0643
FT                   methyltransferase FkbM family; SPTR: C1EI90 Predicted
FT                   protein; TIGRFAM: methyltransferase FkbM family; TIGRFAM:
FT                   methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35622"
FT                   /db_xref="GOA:D5E8W3"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR026913"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W3"
FT                   /protein_id="ADE35622.1"
FT                   /translation="MGFCPENIDSQSVIYSMGIGEDVSWDEALIARKNVTIHGFDPTPR
FT                   AIEYAKNRKLENFIVHPIGVSSKNGYMDFFTPINPSHVSHSLIKKNNTKYSIKVKIKSI
FT                   DSIMDELNHKKIDILKMDIEGSEYEVIPDMLEKKIFPHQLLIEFHHRFDSFTIKNTTDI
FT                   IDELIYYSYKISYISKNKQEFAFIRTTE"
     MGFCPENIDS QSVIYSMGIG EDVSWDEALI ARKNVTIHGF DPTPRAIEYA KNRKLENFIV        60
     HPIGVSSKNG YMDFFTPINP SHVSHSLIKK NNTKYSIKVK IKSIDSIMDE LNHKKIDILK       120
     MDIEGSEYEV IPDMLEKKIF PHQLLIEFHH RFDSFTIKNT TDIIDELIYY SYKISYISKN       180
     KQEFAFIRTT E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page