(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE89

CP001994.PE89        Location/Qualifiers
FT   CDS             complement(96572..97885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0091"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dat:HRM2_19980 glycosyl transferase (group
FT                   1 family protein); PFAM: glycosyl transferase group 1;
FT                   SPTR: A3CU40 Glycosyl transferase, group 1; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35627"
FT                   /db_xref="GOA:D5E8W8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W8"
FT                   /protein_id="ADE35627.1"
FT                   /translation="MLRMTFAGIFKTYISIGKPQGIMIRKLDTYLKKLFITLRFSIQYP
FT                   VICLEKSDILFIAHSYSNFQKESINSTSKYFNKCSVLVEYNPITKISEYINISYLKQFN
FT                   LNYKIDLVDAPPNVNVWPTPILYAPLDSQYKKIGEKHLKAVENKIHKNNINFNLVHAHF
FT                   TWSAGYVGAKLKERYGVPFVVTAHGYDIYLLPFKDNEWKNKIEYVLNSADHIITVSNSN
FT                   ADCIKKLNTNVPVTVIPNGYRSNLFYPIDTLKCRKFLRLPLDKKIILAVGNLVEVKGHK
FT                   YLIESIKRIIGSRKDIQCYIIGWGKLQRKLKKQIAAAGIQDYVKLLGGKPHNEIPLWMN
FT                   ACDVFVLPSLRESFGVVQIEALATGKPVVATFNGGSEEIIVSEDYGLLVNPGNSYELAR
FT                   NIEVALNKEWDTEKILTYAQKYQWENISKQIQEIYQKI"
     MLRMTFAGIF KTYISIGKPQ GIMIRKLDTY LKKLFITLRF SIQYPVICLE KSDILFIAHS        60
     YSNFQKESIN STSKYFNKCS VLVEYNPITK ISEYINISYL KQFNLNYKID LVDAPPNVNV       120
     WPTPILYAPL DSQYKKIGEK HLKAVENKIH KNNINFNLVH AHFTWSAGYV GAKLKERYGV       180
     PFVVTAHGYD IYLLPFKDNE WKNKIEYVLN SADHIITVSN SNADCIKKLN TNVPVTVIPN       240
     GYRSNLFYPI DTLKCRKFLR LPLDKKIILA VGNLVEVKGH KYLIESIKRI IGSRKDIQCY       300
     IIGWGKLQRK LKKQIAAAGI QDYVKLLGGK PHNEIPLWMN ACDVFVLPSL RESFGVVQIE       360
     ALATGKPVVA TFNGGSEEII VSEDYGLLVN PGNSYELARN IEVALNKEWD TEKILTYAQK       420
     YQWENISKQI QEIYQKI                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page