(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE91

CP001994.PE91        Location/Qualifiers
FT   CDS             complement(98441..99220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0093"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: hps:HPSH_00510
FT                   hypothetical protein; PFAM: glycosyl transferase family 2;
FT                   SPTR: Q8PZ41 Glycosyltransferase involved in cell wall
FT                   biogenesis; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35629"
FT                   /db_xref="GOA:D5E8X0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X0"
FT                   /protein_id="ADE35629.1"
FT                   /translation="MQIKNNRTICERLPLISIVTVCLNSETYLKRTIESILNQSYTNIE
FT                   YIIIDGGSTDGTIATIKKYEDSITKWVSEPDDGIYDAMNKGIAMSKGEIIYFLNSGDYL
FT                   YDKSVLYRVATHFLNPRVMGVYGNVEIKDDRGNKRIRGSEVNYNNLLYKRICHQALFVR
FT                   KKLFNELGEFSTYLKLSSDHEFIVKCIKQYKENFVYFNETIAFYMSGGATHIEMKKAKI
FT                   EDLKILSSNYDPLRFFIGTAICLAVIVKYNLPRIYKP"
     MQIKNNRTIC ERLPLISIVT VCLNSETYLK RTIESILNQS YTNIEYIIID GGSTDGTIAT        60
     IKKYEDSITK WVSEPDDGIY DAMNKGIAMS KGEIIYFLNS GDYLYDKSVL YRVATHFLNP       120
     RVMGVYGNVE IKDDRGNKRI RGSEVNYNNL LYKRICHQAL FVRKKLFNEL GEFSTYLKLS       180
     SDHEFIVKCI KQYKENFVYF NETIAFYMSG GATHIEMKKA KIEDLKILSS NYDPLRFFIG       240
     TAICLAVIVK YNLPRIYKP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page