(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE93

CP001994.PE93        Location/Qualifiers
FT   CDS             complement(101298..102332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0095"
FT                   /product="protein of unknown function DUF354"
FT                   /note="COGs: COG1817 conserved hypothetical protein;
FT                   InterPro IPR007152:IPR002073; KEGG: gbm:Gbem_1073 protein
FT                   of unknown function DUF354; PFAM: protein of unknown
FT                   function DUF354; SPTR: A3CU42 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF354)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35631"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X2"
FT                   /protein_id="ADE35631.1"
FT                   /translation="MNIVVDIIHPAHVHFFKNFIHIMEERGHNVLVTSRNKDVAKNLLD
FT                   AYDIEYCTLSTCKSGLLNMGYELIYRDIKLYLKSQSFSPDIFIGEGNPFITHVATLMRK
FT                   TSILFTNTEHAKLINNSSFPFASVICTPSCFNKNLGKKHIRYNGYLAIAYLHPNYFTPN
FT                   PTVLEELDLKEDEPFIILRFVSWEASHDVGHHGIQNKIEFVKELEKYGRVLITSEGDLG
FT                   PEFEKYKITVSPEKLHDLLYYATLYIGEGATTASECAILGTHAIYVNTLRLGYLDEQEE
FT                   KYNLTYTFSDPKNCEKDALDKAISLLKRDNLWEEGKKKRKLLLSDKVDVTDFMVNFIGK
FT                   YKIK"
     MNIVVDIIHP AHVHFFKNFI HIMEERGHNV LVTSRNKDVA KNLLDAYDIE YCTLSTCKSG        60
     LLNMGYELIY RDIKLYLKSQ SFSPDIFIGE GNPFITHVAT LMRKTSILFT NTEHAKLINN       120
     SSFPFASVIC TPSCFNKNLG KKHIRYNGYL AIAYLHPNYF TPNPTVLEEL DLKEDEPFII       180
     LRFVSWEASH DVGHHGIQNK IEFVKELEKY GRVLITSEGD LGPEFEKYKI TVSPEKLHDL       240
     LYYATLYIGE GATTASECAI LGTHAIYVNT LRLGYLDEQE EKYNLTYTFS DPKNCEKDAL       300
     DKAISLLKRD NLWEEGKKKR KLLLSDKVDV TDFMVNFIGK YKIK                        344
//

If you have problems or comments...

PBIL Back to PBIL home page