(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE95

CP001994.PE95        Location/Qualifiers
FT   CDS             103986..104261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0097"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="InterPro IPR006339; SPTR: Q12TS3 Transcriptional
FT                   regulator, AbrB family; TIGRFAM: transcriptional regulator,
FT                   AbrB family; TIGRFAM: looped-hinge helix DNA binding
FT                   domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35633"
FT                   /db_xref="GOA:D5E8X4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X4"
FT                   /protein_id="ADE35633.1"
FT                   /translation="MGYVMTLIDVKSVTVSKKGQITIPGAYRNSGMKIGEKAAVFVYDD
FT                   HIEIRPLSFLEEGLSCAIASQKSLSKGWDTPEEDAAWDHLKDYLGK"
     MGYVMTLIDV KSVTVSKKGQ ITIPGAYRNS GMKIGEKAAV FVYDDHIEIR PLSFLEEGLS        60
     CAIASQKSLS KGWDTPEEDA AWDHLKDYLG K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page