(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE98

CP001994.PE98        Location/Qualifiers
FT   CDS             105767..106606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0100"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006025; SPTR: Q8TN74 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35636"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X7"
FT                   /protein_id="ADE35636.1"
FT                   /translation="MVSKSFDKQYLQKEFEKLNETLNEHVTLYLIGGGSMSFQKYKAAT
FT                   KDIDVVVGSTHELGHVVTALRSINYVIPVVRGPYKKMEANSILENTDGFRWDIFVNVIC
FT                   GGLRLSDGMIERSIQLFKMEHVSVYMICPEDIFVFKSITTRERDQEDMYSLFSKGLNFD
FT                   IIEKEFFWQNNHKQNDYAWMAFFFDGVEEFFDKYHITHPIIARLHDIAEEDMLIGFVKE
FT                   RLRTGPRQISEISDGLDQNDVEVILDKLIKQGVVLKDKYGKISLKSDDDCNQNTGYR"
     MVSKSFDKQY LQKEFEKLNE TLNEHVTLYL IGGGSMSFQK YKAATKDIDV VVGSTHELGH        60
     VVTALRSINY VIPVVRGPYK KMEANSILEN TDGFRWDIFV NVICGGLRLS DGMIERSIQL       120
     FKMEHVSVYM ICPEDIFVFK SITTRERDQE DMYSLFSKGL NFDIIEKEFF WQNNHKQNDY       180
     AWMAFFFDGV EEFFDKYHIT HPIIARLHDI AEEDMLIGFV KERLRTGPRQ ISEISDGLDQ       240
     NDVEVILDKL IKQGVVLKDK YGKISLKSDD DCNQNTGYR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page