(data stored in ACNUC30630 zone)

EMBL: CP002000.COAA

CP002000.COAA        Location/Qualifiers
FT   CDS             complement(191514..192446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="AMED_0179"
FT                   /product="type I pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42002"
FT                   /db_xref="GOA:A0A0H3CTN6"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTN6"
FT                   /protein_id="ADJ42002.1"
FT                   /translation="MTRVRELSPYVELHREQWKELRSSTPLPLTAAELLRLRGLGEQVD
FT                   LAEVADVYLPLSRLINLQVAARQRLYEATTTFLGDDSRGTKVPFVIGIAGSVAVGKSTT
FT                   ARLLRTLLARWPDHPRVDLVTTDGFLYPRAELMRRGIMHRKGFPESYDRRALLRFVTEV
FT                   KSGAERVAAPVYSHLAYDILPGQEQVVQQPDILIVEGLNVLQPGPRLMVSDLFDFSIYV
FT                   DAHTDDIQRWYVERFLELRHTAFADPASHFHHFAGLPDDEARAEARHLWHSINEPNLME
FT                   NIKPTRPRATLVLRKDCDHAINRVRLRKL"
     MTRVRELSPY VELHREQWKE LRSSTPLPLT AAELLRLRGL GEQVDLAEVA DVYLPLSRLI        60
     NLQVAARQRL YEATTTFLGD DSRGTKVPFV IGIAGSVAVG KSTTARLLRT LLARWPDHPR       120
     VDLVTTDGFL YPRAELMRRG IMHRKGFPES YDRRALLRFV TEVKSGAERV AAPVYSHLAY       180
     DILPGQEQVV QQPDILIVEG LNVLQPGPRL MVSDLFDFSI YVDAHTDDIQ RWYVERFLEL       240
     RHTAFADPAS HFHHFAGLPD DEARAEARHL WHSINEPNLM ENIKPTRPRA TLVLRKDCDH       300
     AINRVRLRKL                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page