(data stored in ACNUC30630 zone)

EMBL: CP002000.DNAN

CP002000.DNAN        Location/Qualifiers
FT   CDS             2524..3657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AMED_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41828"
FT                   /db_xref="GOA:A0A0H3CU86"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU86"
FT                   /protein_id="ADJ41828.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDAGSDGETDA
FT                   LTVSGFDYEVSATVGVPATIADGGRLLVSGRLLADITKALPAQPVEISVDGARATITCG
FT                   TARFSLPTMPVEDYPQLPSQPAFAGELAGDAFGQAVTQVVVAAGKDDTLPMLTGMRLEI
FT                   SGSSLTLVATDRFRLAMREFTWQPAEGLADAAVLVPARTLAEAAKTLGASGATIRLALA
FT                   SGEGLLGLSGSGRYTTTRLLDAEFPPYRQLLPASHSSRAVIDVSALTESIKRVSLVAER
FT                   GTQVRLEFGDNTLRLSAGGDDEGSAEEELQVEYEGEPVTIAFNPGYLVDGLGALHSDRA
FT                   ELTFTTPNRPALIKPADAEGNVVPGYLYLLMPVRLPG"
     MKIRVERDGL ADAVAWVARS LPSRPPVPVL GGVLLDAGSD GETDALTVSG FDYEVSATVG        60
     VPATIADGGR LLVSGRLLAD ITKALPAQPV EISVDGARAT ITCGTARFSL PTMPVEDYPQ       120
     LPSQPAFAGE LAGDAFGQAV TQVVVAAGKD DTLPMLTGMR LEISGSSLTL VATDRFRLAM       180
     REFTWQPAEG LADAAVLVPA RTLAEAAKTL GASGATIRLA LASGEGLLGL SGSGRYTTTR       240
     LLDAEFPPYR QLLPASHSSR AVIDVSALTE SIKRVSLVAE RGTQVRLEFG DNTLRLSAGG       300
     DDEGSAEEEL QVEYEGEPVT IAFNPGYLVD GLGALHSDRA ELTFTTPNRP ALIKPADAEG       360
     NVVPGYLYLL MPVRLPG                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page