(data stored in ACNUC30630 zone)

EMBL: CP002000.FTSW

CP002000.FTSW        Location/Qualifiers
FT   CDS             complement(56487..57974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="AMED_0054"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41878"
FT                   /db_xref="GOA:A0A0H3CUC9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUC9"
FT                   /protein_id="ADJ41878.1"
FT                   /translation="MSQPAARAAEPLAAQFQTNPPREVPTRRNTELVLLGFATFIVTVA
FT                   LVLVEANQEQELTASIIWLGLAYLGVLTGAHLAVRKWAPYADPVLLPCVALLNGIGLVM
FT                   IHRIDLALAERATQQGKDYTPAVTAQVLFTVISLVFFVVVLVVVNDHRTLTRYGYTAGL
FT                   IGIVALALPALLPSSLSEVNGAKVWLKLPGFSIQPGEFAKILLMIFFASFLVSKRDLFM
FT                   VAGKKLVGVELPRARDLGPILIAAFVCIGVLVFEKDLGTSLLFFSVILVMLYVATERAI
FT                   WVVLGLSFFAVGCVIAYNLFGHVQQRVANWLDPLATYDQAGGGYQLAQGLFGLGTGGVG
FT                   GTGLGAGRPDMVPEANTDFITASIGEELGFIGLAAVLMLYLLVAMRGMRSALAVRDTFG
FT                   KLLGGGLAFTMVMQIFVVVGGVTKLIPETGITAPFLSKGGSSLLANYILVALLLRISDA
FT                   ARKPASRPKPQQQPQAPIAEAHTVLVQRPPAEGGAQA"
     MSQPAARAAE PLAAQFQTNP PREVPTRRNT ELVLLGFATF IVTVALVLVE ANQEQELTAS        60
     IIWLGLAYLG VLTGAHLAVR KWAPYADPVL LPCVALLNGI GLVMIHRIDL ALAERATQQG       120
     KDYTPAVTAQ VLFTVISLVF FVVVLVVVND HRTLTRYGYT AGLIGIVALA LPALLPSSLS       180
     EVNGAKVWLK LPGFSIQPGE FAKILLMIFF ASFLVSKRDL FMVAGKKLVG VELPRARDLG       240
     PILIAAFVCI GVLVFEKDLG TSLLFFSVIL VMLYVATERA IWVVLGLSFF AVGCVIAYNL       300
     FGHVQQRVAN WLDPLATYDQ AGGGYQLAQG LFGLGTGGVG GTGLGAGRPD MVPEANTDFI       360
     TASIGEELGF IGLAAVLMLY LLVAMRGMRS ALAVRDTFGK LLGGGLAFTM VMQIFVVVGG       420
     VTKLIPETGI TAPFLSKGGS SLLANYILVA LLLRISDAAR KPASRPKPQQ QPQAPIAEAH       480
     TVLVQRPPAE GGAQA                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page