(data stored in ACNUC30630 zone)

EMBL: CP002000.NUOC

CP002000.NUOC        Location/Qualifiers
FT   CDS             522268..523017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="AMED_0522"
FT                   /product="NADH dehydrogenase I subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42342"
FT                   /db_xref="GOA:A0A0H3CUP6"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUP6"
FT                   /protein_id="ADJ42342.1"
FT                   /translation="MTENPQPGEEQSSAERAETGLTAKGPGAAEAVVTGRERQGMFGVH
FT                   GTGDTSGYGGVRLPAYSPAPAERPYGGWFDQFADEFYAALAERKIPAEAILQTTVDRGE
FT                   ITFYVAREHLPSIAKTLRDDGGLRFELLSSVSGVDYGVDVPQRLHAVYHFTSLTYRRRI
FT                   RLEVTLDVEDAHVPSLVETYPTADWQEREAWDMFGIVFDGHPALTRILMPDDWDGHPQR
FT                   KDYPLGGIPVEYKGAEIPPPDQRRSYS"
     MTENPQPGEE QSSAERAETG LTAKGPGAAE AVVTGRERQG MFGVHGTGDT SGYGGVRLPA        60
     YSPAPAERPY GGWFDQFADE FYAALAERKI PAEAILQTTV DRGEITFYVA REHLPSIAKT       120
     LRDDGGLRFE LLSSVSGVDY GVDVPQRLHA VYHFTSLTYR RRIRLEVTLD VEDAHVPSLV       180
     ETYPTADWQE REAWDMFGIV FDGHPALTRI LMPDDWDGHP QRKDYPLGGI PVEYKGAEIP       240
     PPDQRRSYS                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page