(data stored in ACNUC30630 zone)

EMBL: CP002000.NUOI

CP002000.NUOI        Location/Qualifiers
FT   CDS             530346..530870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="AMED_0528"
FT                   /product="NADH dehydrogenase I subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42348"
FT                   /db_xref="GOA:A0A0H3CVN9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN9"
FT                   /protein_id="ADJ42348.1"
FT                   /translation="MGFLDPVKGFGVTFGMMFKKVATEEYPEAGAPAAPRYHGRHQLNR
FT                   HPDGLEKCVGCELCAWACPADAIFVEGGDNTEEARFSPGERYGADYQINYLRCIGCGLC
FT                   IEACPTRSLTMINFYELADDDRQRLIYTKEDLLAPLLPGMEQPPHPMRLGENEQDYYVN
FT                   GPELARGEGIK"
     MGFLDPVKGF GVTFGMMFKK VATEEYPEAG APAAPRYHGR HQLNRHPDGL EKCVGCELCA        60
     WACPADAIFV EGGDNTEEAR FSPGERYGAD YQINYLRCIG CGLCIEACPT RSLTMINFYE       120
     LADDDRQRLI YTKEDLLAPL LPGMEQPPHP MRLGENEQDY YVNGPELARG EGIK             174
//

If you have problems or comments...

PBIL Back to PBIL home page