(data stored in ACNUC30630 zone)

EMBL: CP002000.NUOM

CP002000.NUOM        Location/Qualifiers
FT   CDS             533951..535501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="AMED_0532"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42352"
FT                   /db_xref="GOA:A0A0H3CUQ3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ3"
FT                   /protein_id="ADJ42352.1"
FT                   /translation="MTWLLILILVPLAGSLVLAFLKGNDRAAVLAALGFSILEFLLVIP
FT                   FWLSYTASGPRLQMTSSFDWIPSFGVHIAFGTDGISLIMIAVIALLVPIVVGGLGTLDK
FT                   LPPGRSAGGFLSLILLQEALTIGVFAATDVFLFYVLFEIMLIPMYFLIGGYGGANRQYA
FT                   AVKFFLYSFLGGLIMLASAIGAYSLAADKLGKGTFDWATLVTVVRDAPLSTQIWLFLGF
FT                   FLAFAIKAPLVPFHTWLPDAAGEAPIGVAVLLVGVLDKVGTFGFLRYCLPMFPDASRTL
FT                   APLVLVLSVIGVLYGSILAAGQRDMKRFIAYVSIAHFGFISLGIFAFNEQAMVGSATYM
FT                   LNHSLATGMLIVVIGLVIARGGSSRISDYGGMAKVTPLLAGLFLLAGLSTLSLPGTNSF
FT                   VSEFLVLIGSFVDQPVYTILATVGMVLAAAYVLWLYQRVFQGPVRGDALVGVGGGPGTA
FT                   IAPELGAKKAIRDLNGREIAILAPLVVLILVLGFYPKPVLDTVTPTVQQTLSAVQGGK"
     MTWLLILILV PLAGSLVLAF LKGNDRAAVL AALGFSILEF LLVIPFWLSY TASGPRLQMT        60
     SSFDWIPSFG VHIAFGTDGI SLIMIAVIAL LVPIVVGGLG TLDKLPPGRS AGGFLSLILL       120
     QEALTIGVFA ATDVFLFYVL FEIMLIPMYF LIGGYGGANR QYAAVKFFLY SFLGGLIMLA       180
     SAIGAYSLAA DKLGKGTFDW ATLVTVVRDA PLSTQIWLFL GFFLAFAIKA PLVPFHTWLP       240
     DAAGEAPIGV AVLLVGVLDK VGTFGFLRYC LPMFPDASRT LAPLVLVLSV IGVLYGSILA       300
     AGQRDMKRFI AYVSIAHFGF ISLGIFAFNE QAMVGSATYM LNHSLATGML IVVIGLVIAR       360
     GGSSRISDYG GMAKVTPLLA GLFLLAGLST LSLPGTNSFV SEFLVLIGSF VDQPVYTILA       420
     TVGMVLAAAY VLWLYQRVFQ GPVRGDALVG VGGGPGTAIA PELGAKKAIR DLNGREIAIL       480
     APLVVLILVL GFYPKPVLDT VTPTVQQTLS AVQGGK                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page