(data stored in ACNUC30630 zone)

EMBL: CP002000.NUON

CP002000.NUON        Location/Qualifiers
FT   CDS             535504..537072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="AMED_0533"
FT                   /product="NADH dehydrogenase I subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42353"
FT                   /db_xref="GOA:A0A0H3CVP3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP3"
FT                   /protein_id="ADJ42353.1"
FT                   /translation="MLDILLTQAQPPIVTPSVDYNAVLPVLIIFGAACVSVLVEAFASK
FT                   RSRFGVQVGLSLLAIVAAGAWLIKYAVSDSPAGGVTTFSGAISIDRPALFLWGTLLALA
FT                   VGAVLLISDRVVEPGGALVAQAGIRPGTVQDRAQTATVMQTEVFPLTLFALGGMMAFCA
FT                   SNDLLTMFIALEVLSLPLYLMCGLARRRRLLSQEAAVKYFLLGAFSSAFFLYGLALLYG
FT                   YANSVKLGDIAAAAAGSDRSDTLLFAGLGLLVVGLLFKGSVGPFHTWTPDVYQGAPTPV
FT                   TAFMAACTKVAAFGGILRVLSVAFSSTSWEWRGVLWGVAIISMVIGAVLGLTQTDVKRM
FT                   VAYSSIAHAGFLLVGAIAMTKDGLSSTLFYLLAYGFTTLAAFGVISLVRDSSGEATHLS
FT                   AWAGLAKRSPLVAGVFTFLLLALAGIPLTSGFVGKFVVFSAALSDGMAPLVVIALVFSA
FT                   VAAFFYLRVIVLMYFSEPAADGPSVSVPGFGTGTAIFLGTAVTLVLGLVPAFALGWAGS
FT                   GGFAF"
     MLDILLTQAQ PPIVTPSVDY NAVLPVLIIF GAACVSVLVE AFASKRSRFG VQVGLSLLAI        60
     VAAGAWLIKY AVSDSPAGGV TTFSGAISID RPALFLWGTL LALAVGAVLL ISDRVVEPGG       120
     ALVAQAGIRP GTVQDRAQTA TVMQTEVFPL TLFALGGMMA FCASNDLLTM FIALEVLSLP       180
     LYLMCGLARR RRLLSQEAAV KYFLLGAFSS AFFLYGLALL YGYANSVKLG DIAAAAAGSD       240
     RSDTLLFAGL GLLVVGLLFK GSVGPFHTWT PDVYQGAPTP VTAFMAACTK VAAFGGILRV       300
     LSVAFSSTSW EWRGVLWGVA IISMVIGAVL GLTQTDVKRM VAYSSIAHAG FLLVGAIAMT       360
     KDGLSSTLFY LLAYGFTTLA AFGVISLVRD SSGEATHLSA WAGLAKRSPL VAGVFTFLLL       420
     ALAGIPLTSG FVGKFVVFSA ALSDGMAPLV VIALVFSAVA AFFYLRVIVL MYFSEPAADG       480
     PSVSVPGFGT GTAIFLGTAV TLVLGLVPAF ALGWAGSGGF AF                          522
//

If you have problems or comments...

PBIL Back to PBIL home page