(data stored in ACNUC30630 zone)

EMBL: CP002000.PE107

CP002000.PE107       Location/Qualifiers
FT   CDS             complement(114938..115822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0109"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41933"
FT                   /db_xref="GOA:A0A0H3CUH6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUH6"
FT                   /protein_id="ADJ41933.1"
FT                   /translation="MPEPFDALRRPSERVAPDPDFAAELRDDLRRAILNGADMTTTAVP
FT                   ATAASLRSLTPYLAVSDARAALDFYVEVFGAVRRGDPILMDDGRVGHAELAIGDAVLML
FT                   AEEYPEIGHVAPREGGASVRVEVPDVDGSVARALELGATLIRAVSDSPYGRGGSFRDPF
FT                   GQRWLVSQAATAAAGPRPARHGEAMYFTFQVPEASPAKAFYGAVLGWQFTPGSTTDSWG
FT                   FSGPGLEGGLWAGDRQVGWKLMYAVDDLESAMARVREQGGRAGEVEHHPYGNTADCTDN
FT                   QGIEFWLWEKPGQ"
     MPEPFDALRR PSERVAPDPD FAAELRDDLR RAILNGADMT TTAVPATAAS LRSLTPYLAV        60
     SDARAALDFY VEVFGAVRRG DPILMDDGRV GHAELAIGDA VLMLAEEYPE IGHVAPREGG       120
     ASVRVEVPDV DGSVARALEL GATLIRAVSD SPYGRGGSFR DPFGQRWLVS QAATAAAGPR       180
     PARHGEAMYF TFQVPEASPA KAFYGAVLGW QFTPGSTTDS WGFSGPGLEG GLWAGDRQVG       240
     WKLMYAVDDL ESAMARVREQ GGRAGEVEHH PYGNTADCTD NQGIEFWLWE KPGQ             294
//

If you have problems or comments...

PBIL Back to PBIL home page