(data stored in ACNUC30630 zone)

EMBL: CP002000.PE116

CP002000.PE116       Location/Qualifiers
FT   CDS             complement(125045..126178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTH3"
FT                   /protein_id="ADJ41942.1"
FT                   /translation="MAPDRLAAALARLDEHRELHLPLRRTDLLGRLALRFLWKRQVKWQ
FT                   VEANLAVRDALVAVHELVRAHHEQLGEAGGHGVVRVDHLARELDQLRQQDQTMTAGLNQ
FT                   RLYSGLGRLETQLSDLRLQQAQTAEAETDAEQRLKSLEAQVAALSSTAADVRLRHAQLD
FT                   VALDRIRAGQPVPEVAPAVADRESFLELALSELLDGPADHVRTARRAHLPLVSAAREAG
FT                   ATGPVFDAAPARGEWLEVLRSAGLPYRAASGNSLVRQHCAGLGLDVEPAEPLAALAAVP
FT                   QRSLGAVTAFRFAERLTPGAFARFADLAATALQPGGVLLVELPGDGEAGLDPFAVTPPH
FT                   PIYLRFVAESAGFGDVEVRASEPVGGLGERRCLIARR"
     MAPDRLAAAL ARLDEHRELH LPLRRTDLLG RLALRFLWKR QVKWQVEANL AVRDALVAVH        60
     ELVRAHHEQL GEAGGHGVVR VDHLARELDQ LRQQDQTMTA GLNQRLYSGL GRLETQLSDL       120
     RLQQAQTAEA ETDAEQRLKS LEAQVAALSS TAADVRLRHA QLDVALDRIR AGQPVPEVAP       180
     AVADRESFLE LALSELLDGP ADHVRTARRA HLPLVSAARE AGATGPVFDA APARGEWLEV       240
     LRSAGLPYRA ASGNSLVRQH CAGLGLDVEP AEPLAALAAV PQRSLGAVTA FRFAERLTPG       300
     AFARFADLAA TALQPGGVLL VELPGDGEAG LDPFAVTPPH PIYLRFVAES AGFGDVEVRA       360
     SEPVGGLGER RCLIARR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page