(data stored in ACNUC30630 zone)

EMBL: CP002000.PE125

CP002000.PE125       Location/Qualifiers
FT   CDS             136493..136873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41951"
FT                   /db_xref="InterPro:IPR028965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX90"
FT                   /protein_id="ADJ41951.1"
FT                   /translation="MTIQATASGDDDAALLERLVDRVHRAIRDAGDFDLVDLRWSAGMP
FT                   MLHFGGFDKHGGHLAPEILDLFTRAGELAPGSYGLLHTWDDQDTENDNNFRVYRMARGQ
FT                   VTEREDTHLTPVAPTILDTYEL"
     MTIQATASGD DDAALLERLV DRVHRAIRDA GDFDLVDLRW SAGMPMLHFG GFDKHGGHLA        60
     PEILDLFTRA GELAPGSYGL LHTWDDQDTE NDNNFRVYRM ARGQVTERED THLTPVAPTI       120
     LDTYEL                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page