(data stored in ACNUC30630 zone)

EMBL: CP002000.PE127

CP002000.PE127       Location/Qualifiers
FT   CDS             139126..139566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41953"
FT                   /db_xref="GOA:A0A0H3CUJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUJ7"
FT                   /protein_id="ADJ41953.1"
FT                   /translation="MNRLVRGEDGRDWVVRAQMEWRAPATADDFEHDVAGSYGPGIAMI
FT                   VVTTLLAVILVVWTPDQVNVPAWVLLALLLVVLFFPLRWILRRPWTVVAETEGDVTGDR
FT                   PSERWVGTIRGMFTVQGEVKKISKTIQRHSLPDFDGPLHPVE"
     MNRLVRGEDG RDWVVRAQME WRAPATADDF EHDVAGSYGP GIAMIVVTTL LAVILVVWTP        60
     DQVNVPAWVL LALLLVVLFF PLRWILRRPW TVVAETEGDV TGDRPSERWV GTIRGMFTVQ       120
     GEVKKISKTI QRHSLPDFDG PLHPVE                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page