(data stored in ACNUC30630 zone)

EMBL: CP002000.PE129

CP002000.PE129       Location/Qualifiers
FT   CDS             140596..141921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0131"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41955"
FT                   /db_xref="GOA:A0A0H3CV95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV95"
FT                   /protein_id="ADJ41955.1"
FT                   /translation="MDAVSGFPLAQIVPWGLVVLLVAAMIVLLVRQRKPASVVEDAMLQ
FT                   AVHRMSKAAPNLRAGLDEDAADKITTQLLQMLDCVAVGITDSEGTLLSWDGEANEHYVD
FT                   LVDAIGNAIRKHRREVVAHDRMPCNHRGTCRMKTAVIVPLLVEGETEAALIVVGRTRGR
FT                   LVQMADAVAQFVCTQFELSRLDESKQQLQQAEIKALRAQISPHFVYNALNTISALIRTD
FT                   PEEARELLQDFADFTRYSFRTSGMFTSLAEELRNIDRYLTIENARFGGRLEVRMKIAPE
FT                   VLSVVVPFLIIQPLVENAVKHGLASKPSGGCVTVIAQDYGTEALISVEDDGIGMDPRRL
FT                   KDVKNAHSTGAHVGLGNISQRMQQVFGSDYAVMVETAPGAGMKVTLRVPKFVPGVRPNM
FT                   PDYSSETDAGEADVPPQGGPAQLNGTEVNGVNGTRSGILPMS"
     MDAVSGFPLA QIVPWGLVVL LVAAMIVLLV RQRKPASVVE DAMLQAVHRM SKAAPNLRAG        60
     LDEDAADKIT TQLLQMLDCV AVGITDSEGT LLSWDGEANE HYVDLVDAIG NAIRKHRREV       120
     VAHDRMPCNH RGTCRMKTAV IVPLLVEGET EAALIVVGRT RGRLVQMADA VAQFVCTQFE       180
     LSRLDESKQQ LQQAEIKALR AQISPHFVYN ALNTISALIR TDPEEARELL QDFADFTRYS       240
     FRTSGMFTSL AEELRNIDRY LTIENARFGG RLEVRMKIAP EVLSVVVPFL IIQPLVENAV       300
     KHGLASKPSG GCVTVIAQDY GTEALISVED DGIGMDPRRL KDVKNAHSTG AHVGLGNISQ       360
     RMQQVFGSDY AVMVETAPGA GMKVTLRVPK FVPGVRPNMP DYSSETDAGE ADVPPQGGPA       420
     QLNGTEVNGV NGTRSGILPM S                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page