(data stored in ACNUC30630 zone)

EMBL: CP002000.PE139

CP002000.PE139       Location/Qualifiers
FT   CDS             151172..152014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0141"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41965"
FT                   /db_xref="GOA:A0A0H3CVA5"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA5"
FT                   /protein_id="ADJ41965.1"
FT                   /translation="MTYRLLSVHAHPDDESSKCAATLARYAAEGVEVLVATCTGGERGD
FT                   VLNPALDTPETWADLPAIRRREMAAAAEILGVRQRFLGLVDSGLPAEGEPLPEGCFAAL
FT                   PLSEAAAPLVALIREFRPHVVITYDETGGYPHPDHIRTHEVTVEAFTAAADPARYPGTG
FT                   EPWQPQKLYYQATLSRAWFQALHEATLAAGLESSMAEVLNELPPDKFPVTTKIRCEAHF
FT                   ATRDRALLAHATQVDPAHPFFAHSREIERQVWPHEDYHLAHPAPGPHLEEDLFTGVTP"
     MTYRLLSVHA HPDDESSKCA ATLARYAAEG VEVLVATCTG GERGDVLNPA LDTPETWADL        60
     PAIRRREMAA AAEILGVRQR FLGLVDSGLP AEGEPLPEGC FAALPLSEAA APLVALIREF       120
     RPHVVITYDE TGGYPHPDHI RTHEVTVEAF TAAADPARYP GTGEPWQPQK LYYQATLSRA       180
     WFQALHEATL AAGLESSMAE VLNELPPDKF PVTTKIRCEA HFATRDRALL AHATQVDPAH       240
     PFFAHSREIE RQVWPHEDYH LAHPAPGPHL EEDLFTGVTP                             280
//

If you have problems or comments...

PBIL Back to PBIL home page