(data stored in ACNUC30630 zone)

EMBL: CP002000.PE149

CP002000.PE149       Location/Qualifiers
FT   CDS             complement(159864..160658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41975"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB4"
FT                   /protein_id="ADJ41975.1"
FT                   /translation="MTEAPTSVRRPPAPNPAERAKTIATRNGPASLLPTCDRADLNGER
FT                   VVPVLHHVHRSGSVSVLLADDHPMVRAAKQAQRGELAVMVEVADQAPVDLREPIRGLLW
FT                   ITGWLRPLSPVSARARAVAIAETRPDERLLDVGHGVTLLRLTPASLVLADAEGTHSLRP
FT                   HMFSAAPPDPFHDYEAGWLRHLESDHSDVVEQLAKHLPSALRGGRIRPLGLDRFGLRLR
FT                   VESDTGDHDVRLAFSKSVESPAQLASELRRLVGCPFLRGRSG"
     MTEAPTSVRR PPAPNPAERA KTIATRNGPA SLLPTCDRAD LNGERVVPVL HHVHRSGSVS        60
     VLLADDHPMV RAAKQAQRGE LAVMVEVADQ APVDLREPIR GLLWITGWLR PLSPVSARAR       120
     AVAIAETRPD ERLLDVGHGV TLLRLTPASL VLADAEGTHS LRPHMFSAAP PDPFHDYEAG       180
     WLRHLESDHS DVVEQLAKHL PSALRGGRIR PLGLDRFGLR LRVESDTGDH DVRLAFSKSV       240
     ESPAQLASEL RRLVGCPFLR GRSG                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page