(data stored in ACNUC30630 zone)

EMBL: CP002000.PE168

CP002000.PE168       Location/Qualifiers
FT   CDS             complement(181469..183745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41994"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP4"
FT                   /protein_id="ADJ41994.1"
FT                   /translation="MTTADELLGRLAGLDTAALAKVLAHRPDVLQDPWPRRLDVVAARL
FT                   AAAESIDAALLGLPTPLVQVMRAVQLCYALGQRPAPVAEVARLLGTDAGAVESIVDDLA
FT                   ERALLWPAADGVVLPELLHRNSFAAEGLGQPVGGLLGELGTSRLAKLSRALGLPDTERK
FT                   PQLLLGLVQFFRDGDAVRDLFATAPEETQKLLRDMAEGVPEVQGLAPAGWAFDHGFLYG
FT                   TYYGTVAMPIEVSLALRGPDHQLPFTPGEPAYAVTHTGAEAAEAASAAAALRLLDRVSA
FT                   VLDLAAAEPLPLLKDGSIGTRLVKKLAKDTGATPAEIELAIDLAAQAGLLVADEPPPPR
FT                   RGQKAPAPTLAPDPDLARPAPALLYRLLLTTWWDPAPPEFETDVDALMRRLVLRLLARL
FT                   APGDALDIDALIRLAEWHAPLLPTDDIAGHVRDALGDGELLGVVAHGAVTAAGRALLAP
FT                   DRLVEVTGELVSRARTTALFGTDLTAIVPGSPDARLAALLDRVADREAQGTATSWRFSP
FT                   ASVRRAFDQGATTAGLLDDLRAIAAGDLPQPLVYLVNDVARRHGEAQVYDVASVVVGEP
FT                   AVLAELAAHRKLAKLGLRPVAPTVLTSTVDAARTLEALRDAGYAPTRHAADGSIVLPAR
FT                   DQAEPTLAVRDPEPGELPPDPAGHAERLLAAPASGPALLRGQLARAMSDRYAGRLTPKQ
FT                   QQLCWQLEAGLPVDIAYGGEHLVIAYPELDGDVLDVWSLRERTYRRLELSRIDLAQAST
FT                   AVSLA"
     MTTADELLGR LAGLDTAALA KVLAHRPDVL QDPWPRRLDV VAARLAAAES IDAALLGLPT        60
     PLVQVMRAVQ LCYALGQRPA PVAEVARLLG TDAGAVESIV DDLAERALLW PAADGVVLPE       120
     LLHRNSFAAE GLGQPVGGLL GELGTSRLAK LSRALGLPDT ERKPQLLLGL VQFFRDGDAV       180
     RDLFATAPEE TQKLLRDMAE GVPEVQGLAP AGWAFDHGFL YGTYYGTVAM PIEVSLALRG       240
     PDHQLPFTPG EPAYAVTHTG AEAAEAASAA AALRLLDRVS AVLDLAAAEP LPLLKDGSIG       300
     TRLVKKLAKD TGATPAEIEL AIDLAAQAGL LVADEPPPPR RGQKAPAPTL APDPDLARPA       360
     PALLYRLLLT TWWDPAPPEF ETDVDALMRR LVLRLLARLA PGDALDIDAL IRLAEWHAPL       420
     LPTDDIAGHV RDALGDGELL GVVAHGAVTA AGRALLAPDR LVEVTGELVS RARTTALFGT       480
     DLTAIVPGSP DARLAALLDR VADREAQGTA TSWRFSPASV RRAFDQGATT AGLLDDLRAI       540
     AAGDLPQPLV YLVNDVARRH GEAQVYDVAS VVVGEPAVLA ELAAHRKLAK LGLRPVAPTV       600
     LTSTVDAART LEALRDAGYA PTRHAADGSI VLPARDQAEP TLAVRDPEPG ELPPDPAGHA       660
     ERLLAAPASG PALLRGQLAR AMSDRYAGRL TPKQQQLCWQ LEAGLPVDIA YGGEHLVIAY       720
     PELDGDVLDV WSLRERTYRR LELSRIDLAQ ASTAVSLA                               758
//

If you have problems or comments...

PBIL Back to PBIL home page