(data stored in ACNUC30630 zone)

EMBL: CP002000.PE169

CP002000.PE169       Location/Qualifiers
FT   CDS             complement(183760..184563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41995"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC9"
FT                   /protein_id="ADJ41995.1"
FT                   /translation="MQPKKRFPNWLKIVLAAFTVLFVLGAVFGKAPEPKLTSAAAPATS
FT                   APRPTSTTASPAPTPAAVAYTVGSVTDGATVVVNGSDGTSKTVHVLGVIAPVASTGCYA
FT                   AESLAWATSTLSGNAVKLGAETAQGIALTLADGQDYATLAIQKGYLKYATTAALPALAA
FT                   GESAAKQAVSGLWGPPCQGTIDAPAPAPAPTPAPAPITTPKPAPATKAAPPPAPVETTE
FT                   DAPAPGVYYANCSAAKAAHAAPLHRGEPGYRPALDRDGDGIACER"
     MQPKKRFPNW LKIVLAAFTV LFVLGAVFGK APEPKLTSAA APATSAPRPT STTASPAPTP        60
     AAVAYTVGSV TDGATVVVNG SDGTSKTVHV LGVIAPVAST GCYAAESLAW ATSTLSGNAV       120
     KLGAETAQGI ALTLADGQDY ATLAIQKGYL KYATTAALPA LAAGESAAKQ AVSGLWGPPC       180
     QGTIDAPAPA PAPTPAPAPI TTPKPAPATK AAPPPAPVET TEDAPAPGVY YANCSAAKAA       240
     HAAPLHRGEP GYRPALDRDG DGIACER                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page