(data stored in ACNUC30630 zone)

EMBL: CP002000.PE187

CP002000.PE187       Location/Qualifiers
FT   CDS             200836..201288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42013"
FT                   /db_xref="GOA:A0A0H3CUQ1"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ1"
FT                   /protein_id="ADJ42013.1"
FT                   /translation="MNTTLALSDTFGSDLVRGIGAILLYGVIGLLLMFAGFYAIDWTTP
FT                   GKLSKLVHAGLPNAVIVTASGLLAMSFIVVVAIFNSASDLTEGLITSLVYGLLGIAVQV
FT                   IAVRLLEWATRIDVASTIESEKFAPVSVVVAAAHIGLGLVVAVGIS"
     MNTTLALSDT FGSDLVRGIG AILLYGVIGL LLMFAGFYAI DWTTPGKLSK LVHAGLPNAV        60
     IVTASGLLAM SFIVVVAIFN SASDLTEGLI TSLVYGLLGI AVQVIAVRLL EWATRIDVAS       120
     TIESEKFAPV SVVVAAAHIG LGLVVAVGIS                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page