(data stored in ACNUC30630 zone)

EMBL: CP002000.PE212

CP002000.PE212       Location/Qualifiers
FT   CDS             227258..228226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0215"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42038"
FT                   /db_xref="GOA:A0A0H3CUS3"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS3"
FT                   /protein_id="ADJ42038.1"
FT                   /translation="MTTVEDLPAAGKQPKSARAKILDVVRWVAILLVIGFAAKQLAANW
FT                   GEFWHTLRDVAWESSLLSLVALVAAILVSTWGWQMMVDDLGEPIGYARGAQICLVGSLG
FT                   KYVPGSVWAYLLQMELGRKAGLARARIFTGSLIQLGVGVVSALVVSLLAAPAVFSNSPR
FT                   ALWLFVLIPLGLAMLHPKILTWGTSLVLRILRRPPLQHPLGWRVIGKVFGASTAAWCLQ
FT                   GVHLWLLANSVGTPGLSGFVLCVGAMAVAMTVGTFAFILPSGVGVREVAQVAVLTASGL
FT                   TVGQATAFAVASRVMFTVADLLTAGFAAVAARSVRPAPTPA"
     MTTVEDLPAA GKQPKSARAK ILDVVRWVAI LLVIGFAAKQ LAANWGEFWH TLRDVAWESS        60
     LLSLVALVAA ILVSTWGWQM MVDDLGEPIG YARGAQICLV GSLGKYVPGS VWAYLLQMEL       120
     GRKAGLARAR IFTGSLIQLG VGVVSALVVS LLAAPAVFSN SPRALWLFVL IPLGLAMLHP       180
     KILTWGTSLV LRILRRPPLQ HPLGWRVIGK VFGASTAAWC LQGVHLWLLA NSVGTPGLSG       240
     FVLCVGAMAV AMTVGTFAFI LPSGVGVREV AQVAVLTASG LTVGQATAFA VASRVMFTVA       300
     DLLTAGFAAV AARSVRPAPT PA                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page