(data stored in ACNUC30630 zone)

EMBL: CP002000.PE265

CP002000.PE265       Location/Qualifiers
FT   CDS             complement(281635..282048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0268"
FT                   /product="putative polyketide synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42091"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXN7"
FT                   /protein_id="ADJ42091.1"
FT                   /translation="MTDFAWLEQVPSDRPALIVAEGLTMYLKPESGTELFRRLVEKFPS
FT                   DELICDLFSRTAIKTQKLNGPVRKAGATLYWGVDDPRELERCGLTCESSLDAGHWASPE
FT                   VPARLGRITRFQLRMLKVFPPPARTAHIVRYRF"
     MTDFAWLEQV PSDRPALIVA EGLTMYLKPE SGTELFRRLV EKFPSDELIC DLFSRTAIKT        60
     QKLNGPVRKA GATLYWGVDD PRELERCGLT CESSLDAGHW ASPEVPARLG RITRFQLRML       120
     KVFPPPARTA HIVRYRF                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page