(data stored in ACNUC30630 zone)

EMBL: CP002000.PE267

CP002000.PE267       Location/Qualifiers
FT   CDS             282918..283559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42093"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUX3"
FT                   /protein_id="ADJ42093.1"
FT                   /translation="MITGMDILGAWVRGWAVSRATPAPVAEPDGYRVEVGLPGHRVRYL
FT                   LRAPATVSARARAVAEPGTWLKTCGSRSAVLPGLTPAWTAGETEYLMAFEGPLPAVAVP
FT                   PGYAVTVVGDGPAWDVVVSFGEAPAARGRIAVAGGVAVFDKIETEPARRRRGLGRVVMH
FT                   RLGEAAGARSSALLASEAGRGLYRALGWRVVSDVVPAHVPEGGQEPEVAV"
     MITGMDILGA WVRGWAVSRA TPAPVAEPDG YRVEVGLPGH RVRYLLRAPA TVSARARAVA        60
     EPGTWLKTCG SRSAVLPGLT PAWTAGETEY LMAFEGPLPA VAVPPGYAVT VVGDGPAWDV       120
     VVSFGEAPAA RGRIAVAGGV AVFDKIETEP ARRRRGLGRV VMHRLGEAAG ARSSALLASE       180
     AGRGLYRALG WRVVSDVVPA HVPEGGQEPE VAV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page