(data stored in ACNUC30630 zone)

EMBL: CP002000.PE311

CP002000.PE311       Location/Qualifiers
FT   CDS             complement(325192..326034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42137"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU24"
FT                   /protein_id="ADJ42137.1"
FT                   /translation="MINHDDALKAVASSLDRPSAARIYDYFIGGNTHYAIDRDFAEKVR
FT                   ARLPLIGEYCLTSRQFLGRAVRQCVHEGIRQFVDVGSGLPTAGNVHEVADDTSPRLDTR
FT                   VLYIDNEPIALAHSTLLLADTADPERHHAIAADFLQEDDLWERVKASDIIDVREPIALV
FT                   VNAVMHFVKDEQDPDRLLAFYRERLAPGSLLVLSQMTNENPVNDDERQALLDLLEYYET
FT                   TTNPGFLRTMAEFERFFGGWPLLEPGLVYAPAWHPDEHTVFAGSPSESRVIGGVARKP"
     MINHDDALKA VASSLDRPSA ARIYDYFIGG NTHYAIDRDF AEKVRARLPL IGEYCLTSRQ        60
     FLGRAVRQCV HEGIRQFVDV GSGLPTAGNV HEVADDTSPR LDTRVLYIDN EPIALAHSTL       120
     LLADTADPER HHAIAADFLQ EDDLWERVKA SDIIDVREPI ALVVNAVMHF VKDEQDPDRL       180
     LAFYRERLAP GSLLVLSQMT NENPVNDDER QALLDLLEYY ETTTNPGFLR TMAEFERFFG       240
     GWPLLEPGLV YAPAWHPDEH TVFAGSPSES RVIGGVARKP                             280
//

If you have problems or comments...

PBIL Back to PBIL home page