(data stored in ACNUC30630 zone)

EMBL: CP002000.PE319

CP002000.PE319       Location/Qualifiers
FT   CDS             333592..334233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42145"
FT                   /db_xref="GOA:A0A0H3CVS7"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS7"
FT                   /protein_id="ADJ42145.1"
FT                   /translation="MTSAPSAEDTAGSEARAIAAERLTFFSDAVVAIAITLLALELPLP
FT                   EGATSAELLRSLGHLRSEYVSFLISFIVIGGHWRAHHRLFNYVTTLGGGLARLTFGWLL
FT                   MQVIMPFATKVISEEGGFEFRFVFYAVVQVVALTLFLLMAWQIKRNHLYRADTPPELFG
FT                   KVYRGIGAMIAAFAVSIPVAFFTHWAYACWIVVPLVVSLLSRFRRRTAAA"
     MTSAPSAEDT AGSEARAIAA ERLTFFSDAV VAIAITLLAL ELPLPEGATS AELLRSLGHL        60
     RSEYVSFLIS FIVIGGHWRA HHRLFNYVTT LGGGLARLTF GWLLMQVIMP FATKVISEEG       120
     GFEFRFVFYA VVQVVALTLF LLMAWQIKRN HLYRADTPPE LFGKVYRGIG AMIAAFAVSI       180
     PVAFFTHWAY ACWIVVPLVV SLLSRFRRRT AAA                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page