(data stored in ACNUC30630 zone)

EMBL: CP002000.PE333

CP002000.PE333       Location/Qualifiers
FT   CDS             349686..352253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0336"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42159"
FT                   /db_xref="GOA:A0A0H3CW47"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW47"
FT                   /protein_id="ADJ42159.1"
FT                   /translation="MDLRYEAFCFADPLFYDELQENGAPVEDFTPALPASVAGWVTTDR
FT                   GVWRARHPDGRVLPAQGWQVHVSAGLGNASRVLAQVSESCTEHAVAHKHLRSPLTLLAR
FT                   NSKYASGDSEVELATIYPADDNELERVLMDLSTRLEGEHGPGIPSALQYGDGPLYVRYG
FT                   GFAEQWVEHDGNRVPAVRKPDGRLVPEKREPTSSMPDWVKLPTCLRSSITARKGGARTQ
FT                   FPYRMVRPLHVSNGGGSYLADPKAGGDQVVLKEARPYAGLDEARIDAVERLRREHEVLG
FT                   RLAGIPGVPRAVEWFTVSERHYLAAEYLPGIPLAGWLTRNYPLTRRSTTTVDLADYTRR
FT                   ALDIVEGVEKAIGEAHARGIVLGDLHPQNILVDEDHHDRISLTDFGTAFDAESADRPTP
FT                   GTPGFRAPADRTGFAVDEHALAALRLWLFLPLSPVAELAPAKLRRIADFVERRFPLPEG
FT                   YADAAVAVLAPREVPVEPTLAHTELDHDKPDWSLVRKQIAEAILASATPSRQDRLFPGD
FT                   IEQFRVGGACFGVGAAGVLHALNVAGAGRFPEHERWLIEAVRREPPTRPGFYDGSSGIA
FT                   YVLENFGHHDEAAKLLATSTRLVEQTTDHSLESGLAGIGLTMLHFATVRQDNEFGRQAL
FT                   TTAVRLAEALETAAPPGNSARAGLLAGWAGPALLFIRLFERTGESAWLSFADQALCRDL
FT                   EECVEADDGSLQVRDGAARTLPYAGVGSAGILLAAEQLARHRPDAEAVDSLPALREACL
FT                   GEFVAQPGLLNGRCGLAVALAANPGPGQPSRAAAIDRHLAWLAWYAVPYKNGLAFPGNR
FT                   LLRLSMDVKTGGAGILLSLASLFDGNEVLPFLGGTPIAPATGR"
     MDLRYEAFCF ADPLFYDELQ ENGAPVEDFT PALPASVAGW VTTDRGVWRA RHPDGRVLPA        60
     QGWQVHVSAG LGNASRVLAQ VSESCTEHAV AHKHLRSPLT LLARNSKYAS GDSEVELATI       120
     YPADDNELER VLMDLSTRLE GEHGPGIPSA LQYGDGPLYV RYGGFAEQWV EHDGNRVPAV       180
     RKPDGRLVPE KREPTSSMPD WVKLPTCLRS SITARKGGAR TQFPYRMVRP LHVSNGGGSY       240
     LADPKAGGDQ VVLKEARPYA GLDEARIDAV ERLRREHEVL GRLAGIPGVP RAVEWFTVSE       300
     RHYLAAEYLP GIPLAGWLTR NYPLTRRSTT TVDLADYTRR ALDIVEGVEK AIGEAHARGI       360
     VLGDLHPQNI LVDEDHHDRI SLTDFGTAFD AESADRPTPG TPGFRAPADR TGFAVDEHAL       420
     AALRLWLFLP LSPVAELAPA KLRRIADFVE RRFPLPEGYA DAAVAVLAPR EVPVEPTLAH       480
     TELDHDKPDW SLVRKQIAEA ILASATPSRQ DRLFPGDIEQ FRVGGACFGV GAAGVLHALN       540
     VAGAGRFPEH ERWLIEAVRR EPPTRPGFYD GSSGIAYVLE NFGHHDEAAK LLATSTRLVE       600
     QTTDHSLESG LAGIGLTMLH FATVRQDNEF GRQALTTAVR LAEALETAAP PGNSARAGLL       660
     AGWAGPALLF IRLFERTGES AWLSFADQAL CRDLEECVEA DDGSLQVRDG AARTLPYAGV       720
     GSAGILLAAE QLARHRPDAE AVDSLPALRE ACLGEFVAQP GLLNGRCGLA VALAANPGPG       780
     QPSRAAAIDR HLAWLAWYAV PYKNGLAFPG NRLLRLSMDV KTGGAGILLS LASLFDGNEV       840
     LPFLGGTPIA PATGR                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page