(data stored in ACNUC30630 zone)

EMBL: CP002000.PE355

CP002000.PE355       Location/Qualifiers
FT   CDS             complement(374833..375129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXZ0"
FT                   /protein_id="ADJ42181.1"
FT                   /translation="MAEKAKYRATDITAWLTAAGIDDDAARRAGRVIAGAWNQREFYAS
FT                   ATGLPLAAALTASGLPLARLDTTADGLARRFGVHLHDVAAWDREPHWRKEIST"
     MAEKAKYRAT DITAWLTAAG IDDDAARRAG RVIAGAWNQR EFYASATGLP LAAALTASGL        60
     PLARLDTTAD GLARRFGVHL HDVAAWDREP HWRKEIST                                98
//

If you have problems or comments...

PBIL Back to PBIL home page