(data stored in ACNUC30630 zone)

EMBL: CP002000.PE357

CP002000.PE357       Location/Qualifiers
FT   CDS             complement(375895..376281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV53"
FT                   /protein_id="ADJ42183.1"
FT                   /translation="MPEFLPAPEPAATDMYACLCVHAPTVLTDPSGAIVAVGVTRPAVA
FT                   AAMIRAAAPGLQLPVPDRADAQTFRLRWFAYTHPATPGDPVLRPAGPGEDGAFPVVIWR
FT                   AADQTRARATRDAAHALTVMGVAA"
     MPEFLPAPEP AATDMYACLC VHAPTVLTDP SGAIVAVGVT RPAVAAAMIR AAAPGLQLPV        60
     PDRADAQTFR LRWFAYTHPA TPGDPVLRPA GPGEDGAFPV VIWRAADQTR ARATRDAAHA       120
     LTVMGVAA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page