(data stored in ACNUC30630 zone)

EMBL: CP002000.PE379

CP002000.PE379       Location/Qualifiers
FT   CDS             complement(395271..395975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42205"
FT                   /db_xref="GOA:A0A0H3CVY0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY0"
FT                   /protein_id="ADJ42205.1"
FT                   /translation="MLLRAERPIPSIAVARRSPWALLRYVPNPKTTPFTFGYLVVLLAT
FT                   TLLLEFADPALTTRLLQLSSTDAHNLWRRPLTSLLSSAIWLPGENWLVYALIFAIAVAP
FT                   LERRFGARRTALVFLAGHIVATLVTELPVMALISAHVLPNSAGHWLDIGVSYGFFTTAG
FT                   ALVFLLPGRARLLALAATEAFIAAIWLSDDPTSLDSIVTLLGHAFAAHFGLLVCGPWLR
FT                   ERIRRPSPDFAG"
     MLLRAERPIP SIAVARRSPW ALLRYVPNPK TTPFTFGYLV VLLATTLLLE FADPALTTRL        60
     LQLSSTDAHN LWRRPLTSLL SSAIWLPGEN WLVYALIFAI AVAPLERRFG ARRTALVFLA       120
     GHIVATLVTE LPVMALISAH VLPNSAGHWL DIGVSYGFFT TAGALVFLLP GRARLLALAA       180
     TEAFIAAIWL SDDPTSLDSI VTLLGHAFAA HFGLLVCGPW LRERIRRPSP DFAG             234
//

If you have problems or comments...

PBIL Back to PBIL home page