(data stored in ACNUC30630 zone)

EMBL: CP002000.PE399

CP002000.PE399       Location/Qualifiers
FT   CDS             complement(412217..413359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42225"
FT                   /db_xref="GOA:A0A0H3CW02"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW02"
FT                   /protein_id="ADJ42225.1"
FT                   /translation="MDLTASGVRSTSVTQQARTGLLPANVVLGGSLLSLVGLTWDIQWH
FT                   DDVGPDTFFTLPHLFLYAGSAVVGLASLAVVLLTTAARRAGRPVDPRIGGRVVNVFGRT
FT                   FAAPLGYLVSGVGAATFLLYGLWDQWWHGLYGFDAVIDSPPHIGLLLSITVSLIGTTAV
FT                   FAAAREHRWGRLGTLASLTVLLTFGPVLALGLQQVPDDYADAVAIGTSMMAVLLVSVGA
FT                   GFARRPGGAAGTAALVAVVQAVFWWFSPWAAKAYADLVGLPLRDAVSGVPAMPSLAPMA
FT                   LLPVAALMELVYLAGRRRGWRPGRVSVVAGGIAGLLLGLSLPVQRFLLYTGAHLPPVWY
FT                   LTTTAVLSAALGLLGGFAGWRFGGMLCLLAPAKKGETADA"
     MDLTASGVRS TSVTQQARTG LLPANVVLGG SLLSLVGLTW DIQWHDDVGP DTFFTLPHLF        60
     LYAGSAVVGL ASLAVVLLTT AARRAGRPVD PRIGGRVVNV FGRTFAAPLG YLVSGVGAAT       120
     FLLYGLWDQW WHGLYGFDAV IDSPPHIGLL LSITVSLIGT TAVFAAAREH RWGRLGTLAS       180
     LTVLLTFGPV LALGLQQVPD DYADAVAIGT SMMAVLLVSV GAGFARRPGG AAGTAALVAV       240
     VQAVFWWFSP WAAKAYADLV GLPLRDAVSG VPAMPSLAPM ALLPVAALME LVYLAGRRRG       300
     WRPGRVSVVA GGIAGLLLGL SLPVQRFLLY TGAHLPPVWY LTTTAVLSAA LGLLGGFAGW       360
     RFGGMLCLLA PAKKGETADA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page